Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 4 (TRGV4), Biotinylated

This Recombinant Human T cell receptor gamma variable 4 (TRGV4), Biotinylated spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 4 TRGV4 TCRGV4

UniProt

A0A0C4DH28

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR27 siRNA (Human)
MBS8230622-01 15 nmol

PRR27 siRNA (Human)

Sign In for Pricing
View Details
PRR27 siRNA (Human)
MBS8230622-02 30 nmol

PRR27 siRNA (Human)

Sign In for Pricing
View Details
PRR27 siRNA (Human)
MBS8230622-03 5x 30 nmol

PRR27 siRNA (Human)

Sign In for Pricing
View Details
Bovine Olfactory receptor 10G7 (OR10G7) ELISA Kit
GTR10346611 96 Well

Bovine Olfactory receptor 10G7 (OR10G7) ELISA Kit

Sign In for Pricing
View Details
Ganoderic acid LM2
orb2654811-01 50 mg

Ganoderic acid LM2

Sign In for Pricing
View Details
Ganoderic acid LM2
orb2654811-02 100 mg

Ganoderic acid LM2

Sign In for Pricing
View Details