Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-3 (HV103), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-3 (HV103), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-3 IGHV1-3

UniProt

A0A0C4DH29

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAGE1 Antibody
KC-26889-01 50 μL

PAGE1 Antibody

Sign In for Pricing
View Details
PAGE1 Antibody
KC-26889-02 100 µL

PAGE1 Antibody

Sign In for Pricing
View Details
PAGE1 Antibody
KC-26889-03 1 mL

PAGE1 Antibody

Sign In for Pricing
View Details
ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI4H7]
CF810112 100 µg

ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI4H7]

Sign In for Pricing
View Details
Vonoprazan-d4 Fumarate
TRC-V767014-50MG 50 mg

Vonoprazan-d4 Fumarate

Sign In for Pricing
View Details
Mouse IgG1 (Fcγ Fragment specific), AlpSdAbs® VHH
HA710247 100 µg

Mouse IgG1 (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details