Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-3 (HV103), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-3 (HV103), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-3 IGHV1-3

UniProt

A0A0C4DH29

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XBP1 Mouse Monoclonal Antibody [Clone ID: 1C4]
AM06434SU-N 100 µL

XBP1 Mouse Monoclonal Antibody [Clone ID: 1C4]

Sign In for Pricing
View Details
Mouse Pitpnm2 activation kit by CRISPRa
GA203598 1 Kit

Mouse Pitpnm2 activation kit by CRISPRa

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 alpha (CCL20) (33-44) Goat Polyclonal Antibody
AP31430PU-N 50 µg

Macrophage Inflammatory Protein 3 alpha (CCL20) (33-44) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Fluazolate-d3
TRC-F407502-1MG 1 mg

Fluazolate-d3

Sign In for Pricing
View Details
3,4-Dichloroaniline-d2
TRC-D431803-25MG 25 mg

3,4-Dichloroaniline-d2

Sign In for Pricing
View Details
H3.3B (H3F3B) Human Gene Knockout Kit (CRISPR)
KN402257 1 Kit

H3.3B (H3F3B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details