Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-16 IGHV3-16

UniProt

A0A0C4DH30

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWARKAPGKGLEWVSGVSWNGSRTHYVDSVKRRFIISRDNSRNSLYLQKNRRRAEDMAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(3,5-Dibromo-2-pyridylazo)-N-ethyl-N-(3-sulfo-propyl)aniline Sodium Salt
TRC-D270740-25MG 25 mg

4-(3,5-Dibromo-2-pyridylazo)-N-ethyl-N-(3-sulfo-propyl)aniline Sodium Salt

Sign In for Pricing
View Details
Pcnx4 (NM_026327) Mouse Tagged ORF Clone Lentiviral Particle
MR215705L4V 200 µL

Pcnx4 (NM_026327) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
14-3-3 beta, alpha (Protein 1054, Protein Kinase C Inhibitor Protein 1, KCIP-1, 14-3-3 Protein beta/alpha, N-terminally Processed, YWHAB) (HRP)
028972 100 µg

14-3-3 beta, alpha (Protein 1054, Protein Kinase C Inhibitor Protein 1, KCIP-1, 14-3-3 Protein beta/alpha, N-terminally Processed, YWHAB) (HRP)

Sign In for Pricing
View Details
OR2L3 Polyclonal Antibody
E11-202612 100 µg -100 µL

OR2L3 Polyclonal Antibody

Sign In for Pricing
View Details
Centrifuge 5920R 15/50mL package
E5948000460 1 Each

Centrifuge 5920R 15/50mL package

Sign In for Pricing
View Details
Anti-IL13RA2 Antibody, Rabbit Polyclonal
MBS8102412-01 0.1 mL

Anti-IL13RA2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details