Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-18 (HV118), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-18 (HV118), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-18 IGHV1-18

UniProt

A0A0C4DH31

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EME2 (NM_001010865) Human Over-expression Lysate
LC423193 20 µg

EME2 (NM_001010865) Human Over-expression Lysate

Sign In for Pricing
View Details
21-Deacetoxy Deflazacort
TRC-D198000-5MG 5 mg

21-Deacetoxy Deflazacort

Sign In for Pricing
View Details
2-Nitroisophthalic Acid
TRC-N515275-1G 1 g

2-Nitroisophthalic Acid

Sign In for Pricing
View Details
Mitochondrial Marker (MTC719), CF640R conjugate, 0.1mg/mL
BNC400719-500 1x 500 µL

Mitochondrial Marker (MTC719), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF488A conjugate, 0.1mg/mL
BNC880045-100 1x 100 µL

Bcl-2 (100/D5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-(Acetylthio)propionic Acid
TRC-A188835-1G 1 g

3-(Acetylthio)propionic Acid

Sign In for Pricing
View Details