Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-18 (HV118), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-18 (HV118), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-18 IGHV1-18

UniProt

A0A0C4DH31

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMF2 (C-term) Rabbit Polyclonal Antibody
AP52506PU-N 400 µL

LMF2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS500510 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Pla2g12a (BC026812) Mouse Tagged ORF Clone
MG201855 10 µg

Pla2g12a (BC026812) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TRIM64B Human Gene Knockout Kit (CRISPR)
KN428361 1 Kit

TRIM64B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BRCA1 / RNF53 (N-term) Rabbit Polyclonal Antibody
AP33262PU-N 400 µL

BRCA1 / RNF53 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human C15orf44 (VWA9) activation kit by CRISPRa
GA113063 1 Kit

Human C15orf44 (VWA9) activation kit by CRISPRa

Sign In for Pricing
View Details