Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-24 (HV124), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-24 (HV124), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-24 IGHV1-24

UniProt

A0A0C4DH33

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Verucopeptin
BIBR1110 1 Each

Verucopeptin

Sign In for Pricing
View Details
MIR615 Rat qPCR Primer Pair (MI0012597)
RP300346 200 Reactions

MIR615 Rat qPCR Primer Pair (MI0012597)

Sign In for Pricing
View Details
SGPL1 3'UTR Luciferase Stable Cell Line
TU023072 1.0 mL

SGPL1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human DNAJB14 Recombinant Protein
PPT-12303 100 µg

Human DNAJB14 Recombinant Protein

Sign In for Pricing
View Details
Anti-GTPBP4 Rabbit Monoclonal Antibody
MBS1757883-01 0.03 mL

Anti-GTPBP4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-GTPBP4 Rabbit Monoclonal Antibody
MBS1757883-02 0.1 mL

Anti-GTPBP4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details