Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-24 (HV124), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-24 (HV124), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-24 IGHV1-24

UniProt

A0A0C4DH33

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SHP-1 (Ab-536)
Y021318 100 µg

Anti-SHP-1 (Ab-536)

Sign In for Pricing
View Details
C20orf43 Rabbit Polyclonal Antibody (PE-Cy7)
orb874510 100 µL

C20orf43 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Guinea Pig Olfactory receptor 10AG1 (OR10AG1) ELISA kit
GTR10447874 96 Well

Guinea Pig Olfactory receptor 10AG1 (OR10AG1) ELISA kit

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) trip13 Polyclonal Antibody
MBS7197945 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) trip13 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human IL-22 Polyclonal Antibody
PA88287HU-01 50 µg

Rabbit Anti-Human IL-22 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human IL-22 Polyclonal Antibody
PA88287HU-02 100 µg

Rabbit Anti-Human IL-22 Polyclonal Antibody

Sign In for Pricing
View Details