Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-24 (HV124), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-24 (HV124), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-24 IGHV1-24

UniProt

A0A0C4DH33

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Abhd5 Antibody Picoband® (Dylight488 Conjugate)
PB10021-Dylight488 100 µg

Anti-Abhd5 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
FCRL2 (NM_138738) Human Over-expression Lysate
LC408502 20 µg

FCRL2 (NM_138738) Human Over-expression Lysate

Sign In for Pricing
View Details
ABCC6P1 sgRNA CRISPR Lentivector set (Human)
K0019601 3x 1.0 µg

ABCC6P1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Anti-IL1 beta/IL1B Antibody Picoband®, Dylight594 Conjugate
PA1533-Dylight594 100 µg

Anti-IL1 beta/IL1B Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Ssh2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6388704 1.0 µg DNA

Ssh2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
GUCY2G Protein Vector (Mouse) (pPB-C-His)
PV187394 500 ng

GUCY2G Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details