Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-28 IGHV4-28

UniProt

A0A0C4DH34

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD73 (Immuno-Oncology Target) (NT5E/2505), CF647 conjugate, 0.1mg/mL
BNC472505-500 1x 500 µL

CD73 (Immuno-Oncology Target) (NT5E/2505), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562434 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
3-Bromo-5-hydroxypyridine
TRC-B684472-250MG 250 mg

3-Bromo-5-hydroxypyridine

Sign In for Pricing
View Details
TP53TG3 (NM_016212) Human Recombinant Protein
TP313671 20 µg

TP53TG3 (NM_016212) Human Recombinant Protein

Sign In for Pricing
View Details
Phospho-SMAD1 (S463/465) / SMAD5 (S463/465) / SMAD9 (S465/467) Rabbit polyclonal Antibody
HA500583 100 µL

Phospho-SMAD1 (S463/465) / SMAD5 (S463/465) / SMAD9 (S465/467) Rabbit polyclonal Antibody

Sign In for Pricing
View Details
MS4A13 (NM_001012417) Human Over-expression Lysate
LC422855 20 µg

MS4A13 (NM_001012417) Human Over-expression Lysate

Sign In for Pricing
View Details