Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-28 IGHV4-28

UniProt

A0A0C4DH34

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: JC/70A]
AM50226PU-T 20 µg

CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: JC/70A]

Sign In for Pricing
View Details
CREB1 Antibody
KC-899-01 50 μL

CREB1 Antibody

Sign In for Pricing
View Details
CREB1 Antibody
KC-899-02 100 µL

CREB1 Antibody

Sign In for Pricing
View Details
CREB1 Antibody
KC-899-03 1 mL

CREB1 Antibody

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF568 conjugate, 0.1mg/mL
BNC682026-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LSMD1 (NAA38) activation kit by CRISPRa
GA113510 1 Kit

Human LSMD1 (NAA38) activation kit by CRISPRa

Sign In for Pricing
View Details