Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-28 IGHV4-28

UniProt

A0A0C4DH34

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTSE1 CytoSection
TS402829P5 25 Slides

GTSE1 CytoSection

Sign In for Pricing
View Details
Dub2a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3102705 3x 1.0 µg

Dub2a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
TRNAS10 sgRNA CRISPR Lentivector (Human) (Target 2)
K2522603 1.0 µg DNA

TRNAS10 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Pig Colipase, CLPS ELISA Kit
MBS918432-01 24 Well (LIMIT 1)

Pig Colipase, CLPS ELISA Kit

Sign In for Pricing
View Details
Pig Colipase, CLPS ELISA Kit
MBS918432-02 48 Well

Pig Colipase, CLPS ELISA Kit

Sign In for Pricing
View Details
Pig Colipase, CLPS ELISA Kit
MBS918432-03 96 Well

Pig Colipase, CLPS ELISA Kit

Sign In for Pricing
View Details