Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-28 IGHV4-28

UniProt

A0A0C4DH34

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z-Asp-OH
HY-W011703-01 100 g

Z-Asp-OH

Sign In for Pricing
View Details
Z-Asp-OH
HY-W011703-02 500 g

Z-Asp-OH

Sign In for Pricing
View Details
SRGAP2P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
45457061 1.0 µg DNA

SRGAP2P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
KCNJ1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1120505 3x 1.0 µg

KCNJ1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human DNAJB5 shRNA (UAS) - Lentiviral human DNAJB5 shRNA (UAS, RFP) (100)
GTR15317439 1 Vial

Lentiviral human DNAJB5 shRNA (UAS) - Lentiviral human DNAJB5 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
TPPP3 Double Nickase Plasmid (h)
sc-405113-NIC 20 µg

TPPP3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details