Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bone morphogenetic protein 7 (Bmp7)

Recombinant Mouse Bone morphogenetic protein 7 (Bmp7)

Product Specifications

Product Name Alternative

Osteogenic protein 1

UniProt

P23359

Expression Region

292-430aa

Tag

C-terminal 10xHis-HSA-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

83.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STGGKQRSQNRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPY5R Rabbit mAb
E45R11526N 50 ul

NPY5R Rabbit mAb

Sign In for Pricing
View Details
Rno-miR-495 miRNA Inhibitor
orb1868699-01 10 nmol

Rno-miR-495 miRNA Inhibitor

Sign In for Pricing
View Details
Rno-miR-495 miRNA Inhibitor
orb1868699-02 20 nmol

Rno-miR-495 miRNA Inhibitor

Sign In for Pricing
View Details
LMO3 shRNA Plasmid (m)
sc-75430-SH 20 µg

LMO3 shRNA Plasmid (m)

Sign In for Pricing
View Details
Terf1 Mouse shRNA Plasmid (Locus ID 21749)
TL502256 1 Kit

Terf1 Mouse shRNA Plasmid (Locus ID 21749)

Sign In for Pricing
View Details
PPM1L CRISPR Knock Out 293T Cell Line (Human)
37388141 1x 10^6 Cells / 1.0 mL

PPM1L CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details