Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bone morphogenetic protein 7 (Bmp7)

Recombinant Mouse Bone morphogenetic protein 7 (Bmp7)

Product Specifications

Product Name Alternative

Osteogenic protein 1

UniProt

P23359

Expression Region

292-430aa

Tag

C-terminal 10xHis-HSA-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

83.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STGGKQRSQNRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GPR34 Protein - (Dry Ice)
H00002857-G01 10 µg

Recombinant Human GPR34 Protein - (Dry Ice)

Sign In for Pricing
View Details
Guinea pig Progesterone (PROG) ELISA Kit
NSL0316Gp 96 Tests

Guinea pig Progesterone (PROG) ELISA Kit

Sign In for Pricing
View Details
C22orf36 Double Nickase Plasmid (h)
sc-415808-NIC 20 µg

C22orf36 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
ACO1 Recombinant Protein
OPCD01035-10UG 10 µg

ACO1 Recombinant Protein

Sign In for Pricing
View Details
Boc-Cys (Me) -Oh
OR1028506-01 250 mg

Boc-Cys (Me) -Oh

Sign In for Pricing
View Details
Boc-Cys (Me) -Oh
OR1028506-02 1 g

Boc-Cys (Me) -Oh

Sign In for Pricing
View Details