Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-1 beta (Il1b), Biotinylated

Recombinant Mouse Interleukin-1 beta (Il1b), Biotinylated

Product Specifications

Product Name Alternative

IL-1 beta

UniProt

P10749

Expression Region

118-269aa

Tag

C-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TSGA10IP Antibody
RN-023-01 50 μL

Recombinant TSGA10IP Antibody

Sign In for Pricing
View Details
Recombinant TSGA10IP Antibody
RN-023-02 100 µL

Recombinant TSGA10IP Antibody

Sign In for Pricing
View Details
Recombinant TSGA10IP Antibody
RN-023-03 1 mL

Recombinant TSGA10IP Antibody

Sign In for Pricing
View Details
MUC3 (Mucin 3) (MUC3/2992R), 0.2mg/mL
BNUB2992-100 1x 100 µL

MUC3 (Mucin 3) (MUC3/2992R), 0.2mg/mL

Sign In for Pricing
View Details
25-Deacetyl-23-acetyl Rifampicin (>85%)
TRC-D198200-25MG 25 mg

25-Deacetyl-23-acetyl Rifampicin (>85%)

Sign In for Pricing
View Details
LysoViewTM 633, 10 vials
#70058 1x 10 Each

LysoViewTM 633, 10 vials

Sign In for Pricing
View Details