Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-33 (IL33), partial, Biotinylated

Recombinant Human Interleukin-33 (IL33), partial, Biotinylated

Product Specifications

Product Name Alternative

Interleukin-1 family member 11; Nuclear factor from high endothelial venules

UniProt

O95760

Expression Region

109-270aa

Tag

N-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey 26S proteasome non ATPase regulatory subunit 2 (PSMD2) ELISA Kit
GTR10345397 96 Well

Monkey 26S proteasome non ATPase regulatory subunit 2 (PSMD2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human MAPT/Tau/PHF-tau Protein, C-His
E55P0988 50 µg

Recombinant Human MAPT/Tau/PHF-tau Protein, C-His

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (rMTAP/1813), Biotin conjugate, 0.1mg/mL
BNCB3646-500 1x 500 µL

MTAP (Tumor Suppressor Marker) (rMTAP/1813), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse IL-25(IL-17E) ELISA KIT
E16ME0025-048 48 wells

Mouse IL-25(IL-17E) ELISA KIT

Sign In for Pricing
View Details
Wnt3 Mouse shRNA Lentiviral Particle (Locus ID 22415)
TL515028V 500 µL Each

Wnt3 Mouse shRNA Lentiviral Particle (Locus ID 22415)

Sign In for Pricing
View Details
Human hsa-miR-6791-3p miRNA Antagomir
abx887493-01 10 nmol

Human hsa-miR-6791-3p miRNA Antagomir

Sign In for Pricing
View Details