Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLCO1B3-SLCO1B7 readthrough transcript protein (SO1BT), partial

This Recombinant Human SLCO1B3-SLCO1B7 readthrough transcript protein (SO1BT), partial spans the amino acid sequence from region 431-539. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLCO1B3-SLCO1B7 readthrough transcript protein; Liver specific transporter-3 transmembrane 12; LST-3TM12; Organic anion transporting polypeptide 1B3-1B7; OATP1B3-1B7; Solute carrier organic anion transporter family member 1B3-1B7; SLCO1B3-SLCO1B7; SLCO1B3-SLCO1B7

UniProt

F5H094

Expression Region

431-539

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESKSVAGLTLTYDGNSPVRSHVDVPLSYCNSECNCDESQWEPVCGNNGITYLSPCLAGCKSSSGNKEPIVFYNCSCVEVIGLQNKNYSAHLGECPRDDACTRKSYVYFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-DAXX (Ser213) Rabbit Polyclonal Antibody (RBITC)
orb1045154 100 µL

Phospho-DAXX (Ser213) Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Anti-Human OLR1/LOX1 Antibody (SAA0778)
HX040107 100 µg

Anti-Human OLR1/LOX1 Antibody (SAA0778)

Sign In for Pricing
View Details
Lentiviral mouse Podxl shRNA (UAS) - Lentiviral mouse Podxl shRNA (UAS, iRFP) (25)
GTR15235550 1 Vial

Lentiviral mouse Podxl shRNA (UAS) - Lentiviral mouse Podxl shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
PAM Rabbit Polyclonal Antibody (Fluoro647)
orb3118949 100 µg

PAM Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Lentiviral human OCM2 shRNA (UAS) - Lentiviral human OCM2 shRNA (UAS, iRFP) plasmid
GTR15309199 1 Vial

Lentiviral human OCM2 shRNA (UAS) - Lentiviral human OCM2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Transcription factor E3 Antibody / TFE3
orb1822640 100 µg

Transcription factor E3 Antibody / TFE3

Sign In for Pricing
View Details