Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 2'-5'-oligoadenylate synthase 1 (OAS1)

This Recombinant Human 2'-5'-oligoadenylate synthase 1 (OAS1) spans the amino acid sequence from region 1-400. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E18/E16; p46/p42 OAS

UniProt

P00973

Expression Region

1-400aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Metabolism Research

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.4 kDa

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human EPN3 sgRNA gene knockout kit - Lentiviral human EPN3 sgRNA gene knockout kit (25)
GTR15400281 1 Vial

Lentiviral human EPN3 sgRNA gene knockout kit - Lentiviral human EPN3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Chicken ALAS2/5-aminolevulinate synthase, erythroid-specific, mitochondrial ELISA Kit
MBS2904620-01 48 Well

Chicken ALAS2/5-aminolevulinate synthase, erythroid-specific, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Chicken ALAS2/5-aminolevulinate synthase, erythroid-specific, mitochondrial ELISA Kit
MBS2904620-02 96 Well

Chicken ALAS2/5-aminolevulinate synthase, erythroid-specific, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Chicken ALAS2/5-aminolevulinate synthase, erythroid-specific, mitochondrial ELISA Kit
MBS2904620-03 5x 96 Well

Chicken ALAS2/5-aminolevulinate synthase, erythroid-specific, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Chicken ALAS2/5-aminolevulinate synthase, erythroid-specific, mitochondrial ELISA Kit
MBS2904620-04 10x 96 Well

Chicken ALAS2/5-aminolevulinate synthase, erythroid-specific, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-AEGl Antibody, Affinity Purified
A303-144A-T 2 µg

Rabbit anti-AEGl Antibody, Affinity Purified

Sign In for Pricing
View Details