Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 1A4 (ST1A4)

This Recombinant Human Sulfotransferase 1A4 (ST1A4) spans the amino acid sequence from region 1-295. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sulfotransferase 1A4; ST1A4; EC 2.8.2.1; Aryl sulfotransferase 1A3/1A4; Sulfotransferase 1A3/1A4; SULT1A4

UniProt

P0DMN0

Expression Region

1-295

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM7SF3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
46803126 3x 1.0µg DNA

TM7SF3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
TBK1 Protein Vector (Rat) (pPB-C-His)
PV309970 500 ng

TBK1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Human Fucosyltransferase 6 (FUT6) ELISA Kit
201-12-3818 96 Tests

Human Fucosyltransferase 6 (FUT6) ELISA Kit

Sign In for Pricing
View Details
USP9X Antibody
E51A11801 100 µL

USP9X Antibody

Sign In for Pricing
View Details
Poly-tert-butylphenoldisulfide
90027612-5g 5 g

Poly-tert-butylphenoldisulfide

Sign In for Pricing
View Details
PDIK1L (NM_152835) Human Tagged ORF Clone Lentiviral Particle
RC205597L1V 200 µL

PDIK1L (NM_152835) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details