Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uridine 5'-monophosphate synthase (UMPS)

This Recombinant Human Uridine 5'-monophosphate synthase (UMPS) spans the amino acid sequence from region 2-480. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uridine 5'-monophosphate synthase; UMP synthase; [Includes: Orotate phosphoribosyltransferase; OPRT; OPRTase; EC 2.4.2.10; Orotidine 5'-phosphate decarboxylase; ODC; OMPD; EC 4.1.1.23; OMPdecase] UMPS OK/SW-cl.21

UniProt

P11172

Expression Region

2-480

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAB2 Mouse Monoclonal Antibody [Clone ID: 3B5]
AM06537SU-N 100 µL

TAB2 Mouse Monoclonal Antibody [Clone ID: 3B5]

Sign In for Pricing
View Details
Recombinant CD3 Monoclonal Antibody
AN301033L-01 50 µL

Recombinant CD3 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CD3 Monoclonal Antibody
AN301033L-02 100 µL

Recombinant CD3 Monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung: right lower lobe
CR561218 5 µg

Tissue Total RNA, Lung: right lower lobe

Sign In for Pricing
View Details
SRPR beta (SRPRB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D4]
TA504724BM 100 µL

SRPR beta (SRPRB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D4]

Sign In for Pricing
View Details
CD4, Mouse (T-Cell Marker) (GK1.5), CF488A conjugate, 0.1mg/mL
BNC882009-100 1x 100 µL

CD4, Mouse (T-Cell Marker) (GK1.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details