Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon regulatory factor 8 (IRF8)

This Recombinant Human Interferon regulatory factor 8 (IRF8) spans the amino acid sequence from region 1-426. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon regulatory factor 8; IRF-8; Interferon consensus sequence-binding protein; H-ICSBP; ICSBP; IRF8 ICSBP1

UniProt

Q02556

Expression Region

1-426

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MEK1 (Thr386) Rabbit pAb, BF700 conjugated
orb2855083 100 µL

Phospho-MEK1 (Thr386) Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
USP17L2 Double Nickase Plasmid (h2)
sc-417603-NIC-2 20 µg

USP17L2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
R-(+)-Cotinine
MBS5817233 Inquire

R-(+)-Cotinine

Sign In for Pricing
View Details
TSGA14 (CEP41) (NM_018718) Human Over-expression Lysate
LS095681-20ug 20 µg

TSGA14 (CEP41) (NM_018718) Human Over-expression Lysate

Sign In for Pricing
View Details
FBXW2 Antibody; HRP conjugated
MBS7006494-01 0.05 mg

FBXW2 Antibody; HRP conjugated

Sign In for Pricing
View Details
FBXW2 Antibody; HRP conjugated
MBS7006494-02 0.1 mg

FBXW2 Antibody; HRP conjugated

Sign In for Pricing
View Details