Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon regulatory factor 8 (IRF8)

This Recombinant Human Interferon regulatory factor 8 (IRF8) spans the amino acid sequence from region 1-426. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon regulatory factor 8; IRF-8; Interferon consensus sequence-binding protein; H-ICSBP; ICSBP; IRF8 ICSBP1

UniProt

Q02556

Expression Region

1-426

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Octyl-glycine
CCA47847-01 0.1 g

N-Octyl-glycine

Sign In for Pricing
View Details
N-Octyl-glycine
CCA47847-02 0.25 g

N-Octyl-glycine

Sign In for Pricing
View Details
NKX2-5 (NK2 Transcription Factor Related, locus 5 (Drosophila), CHNG5, CSX, CSX1, NKX2.5, NKX2E, NKX4-1) (APC)
MBS6166537-01 0.1 mL

NKX2-5 (NK2 Transcription Factor Related, locus 5 (Drosophila), CHNG5, CSX, CSX1, NKX2.5, NKX2E, NKX4-1) (APC)

Sign In for Pricing
View Details
NKX2-5 (NK2 Transcription Factor Related, locus 5 (Drosophila), CHNG5, CSX, CSX1, NKX2.5, NKX2E, NKX4-1) (APC)
MBS6166537-02 5x 0.1 mL

NKX2-5 (NK2 Transcription Factor Related, locus 5 (Drosophila), CHNG5, CSX, CSX1, NKX2.5, NKX2E, NKX4-1) (APC)

Sign In for Pricing
View Details
(Propan-2-yl) cyclohexane
orb2893653-01 1 mg

(Propan-2-yl) cyclohexane

Sign In for Pricing
View Details
(Propan-2-yl) cyclohexane
orb2893653-02 5 mg

(Propan-2-yl) cyclohexane

Sign In for Pricing
View Details