Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-10 (LEG10)

This Recombinant Human Galectin-10 (LEG10) spans the amino acid sequence from region 2-142. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Galectin-10; Gal-10; Charcot-Leyden crystal protein; CLC; Eosinophil lysophospholipase; Lysolecithin acylhydrolase; CLC LGALS10 LGALS10A

UniProt

Q05315

Expression Region

2-142

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIRF (UHRF2) Mouse Monoclonal Antibody [Clone:4G10]
E45M19497 100 µg

NIRF (UHRF2) Mouse Monoclonal Antibody [Clone:4G10]

Sign In for Pricing
View Details
RELA Protein Vector (Rat) (pPB-C-His)
PV298746 500 ng

RELA Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal Cyclin A1 Antibody (XLA1-1)
NBP3-07829-20ug 20 µg

Mouse Monoclonal Cyclin A1 Antibody (XLA1-1)

Sign In for Pricing
View Details
SKIP (INPP5K) (NM_130766) Human Over-expression Lysate
E45H13585-2 20 µg

SKIP (INPP5K) (NM_130766) Human Over-expression Lysate

Sign In for Pricing
View Details
USP48 Antibody, Biotin conjugated
MBS7106112-01 0.05 mg

USP48 Antibody, Biotin conjugated

Sign In for Pricing
View Details
USP48 Antibody, Biotin conjugated
MBS7106112-02 0.1 mg

USP48 Antibody, Biotin conjugated

Sign In for Pricing
View Details