Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-10 (LEG10)

This Recombinant Human Galectin-10 (LEG10) spans the amino acid sequence from region 2-142. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Galectin-10; Gal-10; Charcot-Leyden crystal protein; CLC; Eosinophil lysophospholipase; Lysolecithin acylhydrolase; CLC LGALS10 LGALS10A

UniProt

Q05315

Expression Region

2-142

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrgprb4 ORF Vector (Rat) (pORF)
30409016 1.0 µg DNA

Mrgprb4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
TPGS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV668985 1.0 µg DNA

TPGS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
CRYL1 Protein Vector (Human) (pPB-C-His)
PV070913 500 ng

CRYL1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal RASSF10 Antibody [Janelia Fluor 549]
NBP2-41130JF549 0.1 mL

Rabbit Polyclonal RASSF10 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3) (Biotin) discontinued
T8050-45Q-Biotin 100 µL

TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3) (Biotin) discontinued

Sign In for Pricing
View Details
Lead (II) iodide, 99.999%
GX5822-50g 50 g

Lead (II) iodide, 99.999%

Sign In for Pricing
View Details