Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel regulatory subunit beta-1 (SCN1B), partial

This Recombinant Human Sodium channel regulatory subunit beta-1 (SCN1B), partial spans the amino acid sequence from region 19-157. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel regulatory subunit beta-1 SCN1B

UniProt

Q07699

Expression Region

19-157

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF761 (NM_001008401) Human Untagged Clone
SC327997 10 µg

ZNF761 (NM_001008401) Human Untagged Clone

Sign In for Pricing
View Details
Quick-DNA™ Viral Kit (50 Preps) w/ Zymo-Spin™ IC Columns (Capped)
D3015 50 Preparations

Quick-DNA™ Viral Kit (50 Preps) w/ Zymo-Spin™ IC Columns (Capped)

Sign In for Pricing
View Details
Synaptotagmin VII siRNA (h)
sc-41320 10 µM

Synaptotagmin VII siRNA (h)

Sign In for Pricing
View Details
Cleaved-MPO 89k (A49) Polyclonal Antibody
MBS8519116-01 0.1 mg

Cleaved-MPO 89k (A49) Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-MPO 89k (A49) Polyclonal Antibody
MBS8519116-02 0.1 mL (AF635)

Cleaved-MPO 89k (A49) Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-MPO 89k (A49) Polyclonal Antibody
MBS8519116-03 0.1 mL (AF610)

Cleaved-MPO 89k (A49) Polyclonal Antibody

Sign In for Pricing
View Details