Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trafficking protein particle complex subunit 8 (TPPC8), partial

This Recombinant Human Trafficking protein particle complex subunit 8 (TPPC8), partial spans the amino acid sequence from region 1-500. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Trafficking protein particle complex subunit 8; Protein TRS85 homolog; TRAPPC8 KIAA1012

UniProt

Q9Y2L5

Expression Region

1-500

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQCVQSVQELIPDSFVPCVAALCSDEAERLTRLNHLSFAELLKPFSRLTSEVHMRDPNNQLHVIKNLKIAVSNIVTQPPQPGAIRKLLNDVVSGSQPAEGLVANVITAGDYDLNISATTPWFESYRETFLQSMPALDHEFLNHYLACMLVASSSEAEPVEQFSKLSQEQHRIQHNSDYSYPKWFIPNTLKYYVLLHDVSAGDEQRAESIYEEMKQKYGTQGCYLLKINSRTSNRASDEQIPDPWSQYLQKNSIQNQESYEDGPCTITSNKNSDNNLLSLDGLDNEVKDGLPNNFRAHPLQLEQSSDPSNSIDGPDHLRSASSLHETKKGNTGIIHGACLTLTDHDRIRQFIQEFTFRGLLPHIEKTIRQLNDQLISRKGLSRSLFSATKKWFSGSKVPEKSINDLKNTSGLLYPPEAPELQIRKMADLCFLVQHYDLAYSCYHTAKKDFLNDQAMLYAAGALEMAAVSAFLQPGAPRPYPAHYMDTAIQTYRDICKNMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC6 ORF Vector (Human) (pORF)
ORF016965 1.0 µg DNA

CCDC6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Escherichia coli, O, K Serotypes (E. coli) (Biotin)
E3500-06D 1 mL

Escherichia coli, O, K Serotypes (E. coli) (Biotin)

Sign In for Pricing
View Details
Rat Interleukin 1 Receptor Type II (IL-1R2) ELISA Kit
YP-W31792-01 48 Tests

Rat Interleukin 1 Receptor Type II (IL-1R2) ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 1 Receptor Type II (IL-1R2) ELISA Kit
YP-W31792-02 96 Tests

Rat Interleukin 1 Receptor Type II (IL-1R2) ELISA Kit

Sign In for Pricing
View Details
TSC2 (Phospho-Ser1155) (Mouse) Rabbit pAb
MBS8554279-01 0.1 mL

TSC2 (Phospho-Ser1155) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
TSC2 (Phospho-Ser1155) (Mouse) Rabbit pAb
MBS8554279-02 0.1 mL (AF405L)

TSC2 (Phospho-Ser1155) (Mouse) Rabbit pAb

Sign In for Pricing
View Details