Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-5 (SNX5)

This Recombinant Human Sorting nexin-5 (SNX5) spans the amino acid sequence from region 2-404. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sorting nexin-5 SNX5

UniProt

Q9Y5X3

Expression Region

2-404

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD300LG Protein, His Tag
MBS189398-01 0.01 mg

Human CD300LG Protein, His Tag

Sign In for Pricing
View Details
Human CD300LG Protein, His Tag
MBS189398-02 0.05 mg

Human CD300LG Protein, His Tag

Sign In for Pricing
View Details
Human CD300LG Protein, His Tag
MBS189398-03 0.1 mg

Human CD300LG Protein, His Tag

Sign In for Pricing
View Details
Human CD300LG Protein, His Tag
MBS189398-04 5x 0.1 mg

Human CD300LG Protein, His Tag

Sign In for Pricing
View Details
YmgG Antibody
orb836505 2 mg

YmgG Antibody

Sign In for Pricing
View Details
Apaf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6991006 1.0 µg DNA

Apaf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details