Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-5 (SNX5)

This Recombinant Human Sorting nexin-5 (SNX5) spans the amino acid sequence from region 2-404. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sorting nexin-5 SNX5

UniProt

Q9Y5X3

Expression Region

2-404

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc5a1-set siRNA/shRNA/RNAi Lentivector (Rat)
44231096 4x 500 ng

Slc5a1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Jagged1 (JAG1) (NM_000214) Human Over-expression Lysate
LY400079 100 µg

Jagged1 (JAG1) (NM_000214) Human Over-expression Lysate

Sign In for Pricing
View Details
Pwp2 Periodic Tryptophan Protein Homolog (Yeast) Antibody
abx114929 100 µL

Pwp2 Periodic Tryptophan Protein Homolog (Yeast) Antibody

Sign In for Pricing
View Details
Anti-PCSK9 (Evolocumab)-MC-MMAF ADC
ADC-W-2380 1 mg

Anti-PCSK9 (Evolocumab)-MC-MMAF ADC

Sign In for Pricing
View Details
FFAR3, CT (FFAR3, GPR41, Free fatty acid receptor 3, G-protein coupled receptor 41) (MaxLight 550) discontinued
035608-ML550 100 µL

FFAR3, CT (FFAR3, GPR41, Free fatty acid receptor 3, G-protein coupled receptor 41) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Human GYG1 Protein, N-His-SUMO
orb2831718-01 20 µg

Recombinant Human GYG1 Protein, N-His-SUMO

Sign In for Pricing
View Details