Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-5 (TVB65)

This Recombinant Human T cell receptor beta variable 6-5 (TVB65) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-5 TRBV6-5

UniProt

A0A0K0K1A5

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Atrial Natriuretic Peptide (ANP) ELISA Kit
RD-ANP-Ra-48Tests 48 Tests

Rat Atrial Natriuretic Peptide (ANP) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human POMP Protein, N-His
AP93112 50 µg

Recombinant Human POMP Protein, N-His

Sign In for Pricing
View Details
Recombinant human 17 beta-HSD10/HSD17B10 protein
ATGP0518-020 20 µg

Recombinant human 17 beta-HSD10/HSD17B10 protein

Sign In for Pricing
View Details
GANC Antibody, FITC conjugated
A62995-50UL 50 μL

GANC Antibody, FITC conjugated

Sign In for Pricing
View Details
PHLDA3 Recombinant Protein (Human)
RP023362 100 µg

PHLDA3 Recombinant Protein (Human)

Sign In for Pricing
View Details
GRC5/PHF2 Antibody Blocking Peptide
orb1514847 500 µg

GRC5/PHF2 Antibody Blocking Peptide

Sign In for Pricing
View Details