Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-5 (TVB65)

This Recombinant Human T cell receptor beta variable 6-5 (TVB65) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-5 TRBV6-5

UniProt

A0A0K0K1A5

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Iduronate sulfatase, IDS ELISA KIT
E5447Hu-01 48 Well

Human Iduronate sulfatase, IDS ELISA KIT

Sign In for Pricing
View Details
Human Iduronate sulfatase, IDS ELISA KIT
E5447Hu-02 96 Well

Human Iduronate sulfatase, IDS ELISA KIT

Sign In for Pricing
View Details
Human Iduronate sulfatase, IDS ELISA KIT
E5447Hu-03 5x 96 Tests

Human Iduronate sulfatase, IDS ELISA KIT

Sign In for Pricing
View Details
Human Iduronate sulfatase, IDS ELISA KIT
E5447Hu-04 10x 96 Tests

Human Iduronate sulfatase, IDS ELISA KIT

Sign In for Pricing
View Details
Hsa-miR-6771-3p mimic
HY-R02104-01 5 nmol

Hsa-miR-6771-3p mimic

Sign In for Pricing
View Details
Hsa-miR-6771-3p mimic
HY-R02104-02 20 nmol

Hsa-miR-6771-3p mimic

Sign In for Pricing
View Details