Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DNA damage up-regulated protein (DDUP)

This Recombinant Human DNA damage up-regulated protein (DDUP) spans the amino acid sequence from region 1-186. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNA damage up-regulated protein; DDUP; CTBP1-DT

UniProt

C0HM98

Expression Region

1-186

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MWLVECTGRDLTGLSCLLSMDRQPRRRQHVAGCRDVPPPLPQGSWGQTSPRHSILCSKSGCDLLGGGEYNGETSGEEFLAPAWTCRAQQAATWLSVQQTSHKALGPAGGAAMSSKLSPEEQFLSRIHFLRTFMCSVAGAELPGIPQATENGEGCRPARDPASSPSSLSMASVYTQCSSAQLVSALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mycobacterium tuberculosis (TB) Antibody
OAEF00647-1MG 1 mg

Mycobacterium tuberculosis (TB) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Fam78a shRNA (UAS) - Lentiviral mouse Fam78a shRNA (UAS, RFP) plasmid
GTR15115297 1 Vial

Lentiviral mouse Fam78a shRNA (UAS) - Lentiviral mouse Fam78a shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-Napsin A Antibody, Rabbit Polyclonal
MBS8101824-01 0.1 mL

Anti-Napsin A Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Napsin A Antibody, Rabbit Polyclonal
MBS8101824-02 5x 0.1 mL

Anti-Napsin A Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Cavy Brain Natriuretic Peptide ELISA Kit
MBS025207 Inquire

Cavy Brain Natriuretic Peptide ELISA Kit

Sign In for Pricing
View Details
Phospholipase C beta 3 (PLCB3) Rabbit Polyclonal Antibody
TA361451 100 µL

Phospholipase C beta 3 (PLCB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details