Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 5-48 IGLV5-48

UniProt

A0A075B6I7

Expression Region

20-105

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPTSLSASPGASARLTCTLRSGISVGSYRIYWYQQKPGSPPRYLLNYYSDSDKHQGSGVPSRFSGSKDASTNAGILFISGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl-CpG-binding domain protein 5 (MBD5) Mouse ELISA Kit
E9692 96 Tests

Methyl-CpG-binding domain protein 5 (MBD5) Mouse ELISA Kit

Sign In for Pricing
View Details
NEK9 Rabbit Polyclonal Antibody (FITC)
orb3432 100 µL

NEK9 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S), partial
MBS7060846-01 0.02 mg (E-Coli)

Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S), partial

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S), partial
MBS7060846-02 0.1 mg (E-Coli)

Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S), partial

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S), partial
MBS7060846-03 0.02 mg (Yeast)

Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S), partial

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S), partial
MBS7060846-04 0.1 mg (Yeast)

Recombinant Hepatitis B virus genotype C subtype ar Large envelope protein (S), partial

Sign In for Pricing
View Details