Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 5-48 IGLV5-48

UniProt

A0A075B6I7

Expression Region

20-105

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPTSLSASPGASARLTCTLRSGISVGSYRIYWYQQKPGSPPRYLLNYYSDSDKHQGSGVPSRFSGSKDASTNAGILFISGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Ubiquitin carboxyl terminal hydrolase BAP1 (BAP1) ELISA Kit
GTR10355764 96 Well

Porcine Ubiquitin carboxyl terminal hydrolase BAP1 (BAP1) ELISA Kit

Sign In for Pricing
View Details
LDHB discontinued
511094 100 µg

LDHB discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal Cadherin-8 Antibody [DyLight 350]
NBP2-98434UV 0.1 mL

Rabbit Polyclonal Cadherin-8 Antibody [DyLight 350]

Sign In for Pricing
View Details
Zyxin (Phospho-Ser142) Antibody
E11-8453A 100 µg

Zyxin (Phospho-Ser142) Antibody

Sign In for Pricing
View Details
Recombinant Candida glabrata Mediator of RNA polymerase II transcription subunit 7 (MED7)
MBS1467872-01 0.05 mg (E-Coli)

Recombinant Candida glabrata Mediator of RNA polymerase II transcription subunit 7 (MED7)

Sign In for Pricing
View Details
Recombinant Candida glabrata Mediator of RNA polymerase II transcription subunit 7 (MED7)
MBS1467872-02 0.05 mg (Yeast)

Recombinant Candida glabrata Mediator of RNA polymerase II transcription subunit 7 (MED7)

Sign In for Pricing
View Details