Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11)

This Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11) spans the amino acid sequence from region 19-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable 11 TRGV11

UniProt

A0A075B6L2

Expression Region

19-119

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLEQPEISISRPANKSAHISWKASIQGFSSKIIHWYWQKPNKGLEYLLHVFLTISAQDCSGGKTKKLEVSKNAHTSTSTLKIKFLEKEDEVVYHCACWIRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sec61a1 Pre-designed siRNA Set A
SI112641A 1 Each

Mouse Sec61a1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CD4 (T-cell Surface Glycoprotein CD4, T-cell Surface Antigen T4/Leu-3) (AP)
MBS6260320-01 0.1 mL

CD4 (T-cell Surface Glycoprotein CD4, T-cell Surface Antigen T4/Leu-3) (AP)

Sign In for Pricing
View Details
CD4 (T-cell Surface Glycoprotein CD4, T-cell Surface Antigen T4/Leu-3) (AP)
MBS6260320-02 5x 0.1 mL

CD4 (T-cell Surface Glycoprotein CD4, T-cell Surface Antigen T4/Leu-3) (AP)

Sign In for Pricing
View Details
Mouse Monoclonal CLEC4E Antibody (OTI2A8) [mFluor Violet 610 SE]
NBP2-71793MFV610 0.1 mL

Mouse Monoclonal CLEC4E Antibody (OTI2A8) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Diamino Biotin
sc-391399C 25 mg

Diamino Biotin

Sign In for Pricing
View Details
Carbocisteine Impurity 29
RM-C010229-01 10 mg

Carbocisteine Impurity 29

Sign In for Pricing
View Details