Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17)

This Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-17 IGKV1D-17

UniProt

A0A075B6S4

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCL20/MIP-3 alpha Recombinant Rabbit monoclonal Antibody
HA725010 100 µL

Human CCL20/MIP-3 alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Benzylamine
TRC-B224860-5G 5 g

Benzylamine

Sign In for Pricing
View Details
Recombinant Rat IL18R1 Protein (Fc Tag)
PKSR030330 100 µg

Recombinant Rat IL18R1 Protein (Fc Tag)

Sign In for Pricing
View Details
TAK1 Recombinant Rabbit monoclonal Antibody
HA750424 100 µL

TAK1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Ccm2 Mouse Gene Knockout Kit (CRISPR)
KN502800 1 Kit

Ccm2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C14orf38 (CCDC175) activation kit by CRISPRa
GA119020 1 Kit

Human C14orf38 (CCDC175) activation kit by CRISPRa

Sign In for Pricing
View Details