Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17)

This Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-17 IGKV1D-17

UniProt

A0A075B6S4

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(2-Furyl)ethanol-d3
TRC-F865262-2.5MG 2.5 mg

1-(2-Furyl)ethanol-d3

Sign In for Pricing
View Details
CIB3 Mouse Monoclonal Antibody [Clone ID: OTI5F12]
CF811077 100 µg

CIB3 Mouse Monoclonal Antibody [Clone ID: OTI5F12]

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF647 conjugate, 0.1mg/mL
BNC471784-100 1x 100 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGP2 (MFAP5) (NM_003480) Human Over-expression Lysate
LY401177 100 µg

MAGP2 (MFAP5) (NM_003480) Human Over-expression Lysate

Sign In for Pricing
View Details
TIRAP Polyclonal Antibody
E-AB-17096-01 20 µL

TIRAP Polyclonal Antibody

Sign In for Pricing
View Details
TIRAP Polyclonal Antibody
E-AB-17096-02 60 µL

TIRAP Polyclonal Antibody

Sign In for Pricing
View Details