Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative aquaporin-7B (AQP7B), partial

This Recombinant Human Putative aquaporin-7B (AQP7B), partial spans the amino acid sequence from region 137-174. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative aquaporin-7B AQP7B

UniProt

A0A075B734

Expression Region

137-174

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LFYTAILHFSGGELMVTGPFATAGIFATYLPDHMTLWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1565744 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6478208 1.0 µg DNA

RGD1565744 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
KIR3DL1 Polyclonal Antibody, PE Conjugated
bs-2421R-PE 100 µL

KIR3DL1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
CRLS1 Protein Vector (Mouse) (pPB-C-His)
PV168098 500 ng

CRLS1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Relfovetmab Biosimilar - Research Grade
ICH5814-10mg 10 mg (2x 5 mg)

Relfovetmab Biosimilar - Research Grade

Sign In for Pricing
View Details
Amyloid beta-Protein (1-40) (mouse, rat)
FA109563-01 250 µg

Amyloid beta-Protein (1-40) (mouse, rat)

Sign In for Pricing
View Details
Amyloid beta-Protein (1-40) (mouse, rat)
FA109563-02 500 µg

Amyloid beta-Protein (1-40) (mouse, rat)

Sign In for Pricing
View Details