Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-40 (KV240)

This Recombinant Human Immunoglobulin kappa variable 2-40 (KV240) spans the amino acid sequence from region 20-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-40 IGKV2-40

UniProt

A0A087WW87

Expression Region

20-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGR2 Protein Lysate
OCOA20726-20UG 20 µg

PTGR2 Protein Lysate

Sign In for Pricing
View Details
FIBP (NM_004214) Human 3' UTR Clone
SC202806 10 µg

FIBP (NM_004214) Human 3' UTR Clone

Sign In for Pricing
View Details
WSTF siRNA (h)
sc-38619 10 µM

WSTF siRNA (h)

Sign In for Pricing
View Details
Nfe2l3 Rabbit Polyclonal Antibody (BF680)
orb2468757 100 µL

Nfe2l3 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Tradipitant
MBS5755654 Inquire

Tradipitant

Sign In for Pricing
View Details
A-304121
T29508-01 25 mg

A-304121

Sign In for Pricing
View Details