Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1)

This Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1) spans the amino acid sequence from region 21-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable TRGV1

UniProt

A0A0A0MS02

Expression Region

21-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLEGRTKSVTRLTGSSAEITCDLPGASTLYIHWYLHQEGKAPQCLLYYEPYYSRVVLESGITPGKYDTGSTRSNWNLRLQNLIKNDSGFYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-hydrazino TentaGel® TRT Resin
S30070.25G 25 g

Fmoc-hydrazino TentaGel® TRT Resin

Sign In for Pricing
View Details
Telethonin (TCAP) (NM_003673) Human Over-expression Lysate
LY401215 100 µg

Telethonin (TCAP) (NM_003673) Human Over-expression Lysate

Sign In for Pricing
View Details
TMEM253 (NM_001146683) Human Over-expression Lysate
LC431176 20 µg

TMEM253 (NM_001146683) Human Over-expression Lysate

Sign In for Pricing
View Details
Human C7orf36 (YAE1D1) activation kit by CRISPRa
GA111332 1 Kit

Human C7orf36 (YAE1D1) activation kit by CRISPRa

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details