Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1)

This Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1) spans the amino acid sequence from region 21-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable TRGV1

UniProt

A0A0A0MS02

Expression Region

21-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLEGRTKSVTRLTGSSAEITCDLPGASTLYIHWYLHQEGKAPQCLLYYEPYYSRVVLESGITPGKYDTGSTRSNWNLRLQNLIKNDSGFYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2,2-Trifluoroethyl Tosylate
TRC-T790230-50G 50 g

2,2,2-Trifluoroethyl Tosylate

Sign In for Pricing
View Details
Human ULBP1 Recombinant Rabbit monoclonal Antibody
HA723410B 100 µL

Human ULBP1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse C1galt1c1 activation kit by CRISPRa
GA206357 1 Kit

Mouse C1galt1c1 activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF387 Antibody
8C10130-AAT 50 µg

ZNF387 Antibody

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), 0.2mg/mL
BNUB1863-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), 0.2mg/mL

Sign In for Pricing
View Details
Dipropyl Sodium Phosphate
TRC-D492390-50MG 50 mg

Dipropyl Sodium Phosphate

Sign In for Pricing
View Details