Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-8 (TVB68)

This Recombinant Human T cell receptor beta variable 6-8 (TVB68) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-8 TRBV6-8

UniProt

A0A0A6YYG3

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYMSWYRQDPGMGLRLIYYSAAAGTTDKEVPNGYNVSRLNTEDFPLRLVSAAPSQTSVYLCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 (MAP3K7IP3) ELISA Kit
RK12170 96 Tests

Human TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 (MAP3K7IP3) ELISA Kit

Sign In for Pricing
View Details
TREML1 siRNA (Mouse)
orb1840865-01 15 nmol

TREML1 siRNA (Mouse)

Sign In for Pricing
View Details
TREML1 siRNA (Mouse)
orb1840865-02 30 nmol

TREML1 siRNA (Mouse)

Sign In for Pricing
View Details
AHSG Recombinant Protein
OPCD01214-10UG 10 µg

AHSG Recombinant Protein

Sign In for Pricing
View Details
2-chloro-6- (methylthio) nicotinaldehyde
OR1082099-01 250 mg

2-chloro-6- (methylthio) nicotinaldehyde

Sign In for Pricing
View Details
2-chloro-6- (methylthio) nicotinaldehyde
OR1082099-02 500 mg

2-chloro-6- (methylthio) nicotinaldehyde

Sign In for Pricing
View Details