Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-21 (HV321)

This Recombinant Human Immunoglobulin heavy variable 3-21 (HV321) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-21 IGHV3-21

UniProt

A0A0B4J1V1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM13C1 Rabbit Polyclonal Antibody (HRP)
orb481290 100 µL

FAM13C1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
N4-Acetyl-CTP 100mM Sodium Solution
CTPAC001-500 500 mL

N4-Acetyl-CTP 100mM Sodium Solution

Sign In for Pricing
View Details
EGLN1 (Egl-9 Family Hypoxia-inducible Factor 1, C1orf12, DKFZp761F179, ECYT3, HIFPH2, HPH2, PHD2, SM-20, SM20, ZMYND6) (FITC)
MBS6415323-01 0.1 mL

EGLN1 (Egl-9 Family Hypoxia-inducible Factor 1, C1orf12, DKFZp761F179, ECYT3, HIFPH2, HPH2, PHD2, SM-20, SM20, ZMYND6) (FITC)

Sign In for Pricing
View Details
EGLN1 (Egl-9 Family Hypoxia-inducible Factor 1, C1orf12, DKFZp761F179, ECYT3, HIFPH2, HPH2, PHD2, SM-20, SM20, ZMYND6) (FITC)
MBS6415323-02 5x 0.1 mL

EGLN1 (Egl-9 Family Hypoxia-inducible Factor 1, C1orf12, DKFZp761F179, ECYT3, HIFPH2, HPH2, PHD2, SM-20, SM20, ZMYND6) (FITC)

Sign In for Pricing
View Details
ZIC3 Antibody
A38694-100UL 100 µL

ZIC3 Antibody

Sign In for Pricing
View Details
Recombinant human ZNF689 protein
ATGP2388-100 100 µg

Recombinant human ZNF689 protein

Sign In for Pricing
View Details