Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-2 (TVA82)

This Recombinant Human T cell receptor alpha variable 8-2 (TVA82) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-2 TRAV8-2

UniProt

A0A0B4J237

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQHPNKGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SN-38 Glucuronide-d5
TRC-S589984-5MG 5 mg

SN-38 Glucuronide-d5

Sign In for Pricing
View Details
C7orf61 (NM_001004323) Human Recombinant Protein
TP307300M 100 µg

C7orf61 (NM_001004323) Human Recombinant Protein

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF405S conjugate, 0.1mg/mL
BNC042063-100 1x 100 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nonactin
SIH-372-5MG 5 mg

Nonactin

Sign In for Pricing
View Details
Cystatin SA (CST2) (NM_001322) Human Recombinant Protein
TP720294M 50 µg

Cystatin SA (CST2) (NM_001322) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S1 Protein, Biotinylated (His Tag)
PKSR030515 20 µg

Recombinant SARS-CoV-2 S1 Protein, Biotinylated (His Tag)

Sign In for Pricing
View Details