Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2)

This Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-2 TRAV26-2

UniProt

A0A0B4J265

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 647 Anti-human CD36 Antibody *CB38*
103600F0-AAT 100 Tests

IFluor® 647 Anti-human CD36 Antibody *CB38*

Sign In for Pricing
View Details
Cat NADH-Ubiquinone Oxidoreductase Chain 4 (MT-ND4) ELISA Kit
MBS9399911 Inquire

Cat NADH-Ubiquinone Oxidoreductase Chain 4 (MT-ND4) ELISA Kit

Sign In for Pricing
View Details
His tag Recombinant Antibody, PE Conjugated
bsm-33004R-PE-TR 20 µL

His tag Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
SARS-CoV-2 Spike Protein Antibody, InVivo Block/Neutralizing Antibody
ANT-37481-1mg 1 mg

SARS-CoV-2 Spike Protein Antibody, InVivo Block/Neutralizing Antibody

Sign In for Pricing
View Details
Rabbit anti-neutrophil granules antibody (ANGA) ELISA Kit
EIA05259Rb 1 Kit

Rabbit anti-neutrophil granules antibody (ANGA) ELISA Kit

Sign In for Pricing
View Details
ZNF418 Human shRNA Plasmid Kit (Locus ID 147686)
TR300211 1 Kit

ZNF418 Human shRNA Plasmid Kit (Locus ID 147686)

Sign In for Pricing
View Details