Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2)

This Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-2 TRAV26-2

UniProt

A0A0B4J265

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apg7, CT (Apg 7, APG7 Autophagy 7 Like, APG7 Autophagy 7-like (S. cerevisiae), APG7 Like, APG7, S. cerevisiae, Homolog of, APG7-like, APG7L, ATG 7, ATG12-activating Enzyme E1 ATG7, Atg7, ATG7 Autophagy Related 7 Homolog (S. cerevisiae), ATG7 Autophagy Related 7 Homolog, Atg7l, Autophagy 7, S. cerevisiae, Homolog of, Autophagy Related Protein 7, Autophagy-related 7 (Yeast), Autophagy-related Protein 7, GSA 7, GSA7, HAGP7, Ubiquitin Activating Enzyme E1 Like Protein, Ubiquitin-activating Enzyme E1-like Protein, Ubiquitin-like Modifier-activating Enzyme ATG7)
303122 100 µg

Apg7, CT (Apg 7, APG7 Autophagy 7 Like, APG7 Autophagy 7-like (S. cerevisiae), APG7 Like, APG7, S. cerevisiae, Homolog of, APG7-like, APG7L, ATG 7, ATG12-activating Enzyme E1 ATG7, Atg7, ATG7 Autophagy Related 7 Homolog (S. cerevisiae), ATG7 Autophagy Related 7 Homolog, Atg7l, Autophagy 7, S. cerevisiae, Homolog of, Autophagy Related Protein 7, Autophagy-related 7 (Yeast), Autophagy-related Protein 7, GSA 7, GSA7, HAGP7, Ubiquitin Activating Enzyme E1 Like Protein, Ubiquitin-activating Enzyme E1-like Protein, Ubiquitin-like Modifier-activating Enzyme ATG7)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Protein swallow (swa), partial
MBS1219662 Inquire

Recombinant Drosophila melanogaster Protein swallow (swa), partial

Sign In for Pricing
View Details
IKK gamma Antibody
ASA-B0988 1 Each

IKK gamma Antibody

Sign In for Pricing
View Details
FBXO33 antibody - middle region
MBS3212486-01 0.1 mL

FBXO33 antibody - middle region

Sign In for Pricing
View Details
FBXO33 antibody - middle region
MBS3212486-02 5x 0.1 mL

FBXO33 antibody - middle region

Sign In for Pricing
View Details
GRP78/Bip Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62645R-PerCP-Cy5.5 100 µL

GRP78/Bip Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details