Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40)

This Recombinant Human T cell receptor alpha variable 40 (TVA40) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP1, ID (MMP1, CLG, Interstitial collagenase, Fibroblast collagenase, Matrix metalloproteinase-1, 22kD interstitial collagenase, 27kD interstitial collagenase) (Biotin) discontinued
038498-Biotin 200 µL

MMP1, ID (MMP1, CLG, Interstitial collagenase, Fibroblast collagenase, Matrix metalloproteinase-1, 22kD interstitial collagenase, 27kD interstitial collagenase) (Biotin) discontinued

Sign In for Pricing
View Details
ALOX12 Rabbit Polyclonal Antibody (C-term)
E28PB2632 100 µL

ALOX12 Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details
Csnk2b Rabbit Polyclonal Antibody
TA346545 100 µL

Csnk2b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Neurospora crassa Nucleolar protein 16 (nop-16)
MBS1292625-01 0.02 mg (E-Coli)

Recombinant Neurospora crassa Nucleolar protein 16 (nop-16)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Nucleolar protein 16 (nop-16)
MBS1292625-02 0.1 mg (E-Coli)

Recombinant Neurospora crassa Nucleolar protein 16 (nop-16)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Nucleolar protein 16 (nop-16)
MBS1292625-03 0.02 mg (Yeast)

Recombinant Neurospora crassa Nucleolar protein 16 (nop-16)

Sign In for Pricing
View Details