Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40)

This Recombinant Human T cell receptor alpha variable 40 (TVA40) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm5151 Protein Vector (Mouse) (pPM-C-HA)
22082024 500 ng

Gm5151 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rat Hepcidin Antimicrobial Peptide ELISA Kit (Colorimetric)
NBP2-82130 1 Kit

Rat Hepcidin Antimicrobial Peptide ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Lentiviral mouse Arf4 shRNA (UAS) - Lentiviral mouse Arf4 shRNA (UAS, GFP) (100)
GTR15186153 1 Vial

Lentiviral mouse Arf4 shRNA (UAS) - Lentiviral mouse Arf4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
IBSP Rabbit Polyclonal Antibody
orb666959-01 30 µL

IBSP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IBSP Rabbit Polyclonal Antibody
orb666959-02 50 μL

IBSP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IBSP Rabbit Polyclonal Antibody
orb666959-03 100 µL

IBSP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details