Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-16 IGHV3-16

UniProt

A0A0C4DH30

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWARKAPGKGLEWVSGVSWNGSRTHYVDSVKRRFIISRDNSRNSLYLQKNRRRAEDMAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Bsn activation kit by CRISPRa
GA200445 1 Kit

Mouse Bsn activation kit by CRISPRa

Sign In for Pricing
View Details
Scoparone
TRC-S199980-25MG 25 mg

Scoparone

Sign In for Pricing
View Details
34S-Phenylacetyl Disulfide
TRC-P335599-1MG 1 mg

34S-Phenylacetyl Disulfide

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3083), CF740 conjugate, 0.1mg/mL
BNC743083-500 1x 500 µL

Cathepsin D (Tumor Marker) (CTSD/3083), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HTR2C Rabbit Polyclonal Antibody
AP01291PU-N 100 µg

HTR2C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Factor X (F10) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A9]
TA811724AM 100 µL

Factor X (F10) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A9]

Sign In for Pricing
View Details