Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-16 IGHV3-16

UniProt

A0A0C4DH30

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWARKAPGKGLEWVSGVSWNGSRTHYVDSVKRRFIISRDNSRNSLYLQKNRRRAEDMAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK3/MST-2Antibody (YA2083, Rabbit)
HY-P82338-01 10 µL

STK3/MST-2Antibody (YA2083, Rabbit)

Sign In for Pricing
View Details
STK3/MST-2Antibody (YA2083, Rabbit)
HY-P82338-02 50 μL

STK3/MST-2Antibody (YA2083, Rabbit)

Sign In for Pricing
View Details
STK3/MST-2Antibody (YA2083, Rabbit)
HY-P82338-03 100 µL

STK3/MST-2Antibody (YA2083, Rabbit)

Sign In for Pricing
View Details
GLUD2 Human shRNA Plasmid Kit (Locus ID 2747)
TL312741 1 Kit

GLUD2 Human shRNA Plasmid Kit (Locus ID 2747)

Sign In for Pricing
View Details
PLV2-EGFP-BAP1-HA-Puro Plasmid
PVT80300 2 µg

PLV2-EGFP-BAP1-HA-Puro Plasmid

Sign In for Pricing
View Details
Monkey Stathmin 2 (STMN2) ELISA kit
GTR10382235 96 Well

Monkey Stathmin 2 (STMN2) ELISA kit

Sign In for Pricing
View Details